yarceful
yarceful
10-02-2015
English
Answered
what are equivalent ratios to 8/11?
Answer :
ScarletIbis
ScarletIbis
10-02-2015
there are lots such as 16/22. You find them by either multiplying or dividing the numerator and denominator by the same number. Hope this helped :)
Answer Link
VIEW ALL ANSWERS ( 74+ )
Other Questions
-Use the Shell Method to find the volume of the solid obtained by rotating region B in the figure about the line x = -3.0y=x²+bBAssume a = 5 and b = 5.(Use symb
Se le llama así a la función que tiene la forma siguiente:[tex]y = ax^2 + bx + c[/tex]A. Función Constante B. Función Lineal C. Función Cuadrática D. Función
Which expression is equivalent to [tex]\frac{-9 x^{-1} y^{-9}}{-15 x^5 y^{-3}}[/tex]? Assume [tex]x \neq 0, y \neq 0[/tex].A. [tex]\frac{3}{5 x^5 y^3}[/tex]B. [
The function [tex]\( f \)[/tex] is defined as[tex]\[ f: x \mapsto \frac{3x+1}{x-2} \][/tex](a) State the value of [tex]\( x \)[/tex] that cannot be included in
In what cases does the vice president become president? Select all that apply.A. The president dies.B. The president is removed from office.C. The president res
Find the period and amplitude of the function.[tex]\[ y = 4 \sin 6x \][/tex]Give the exact values, not decimal approximations.Period: [tex]\(\boxed{\frac{\pi}{3
what kind of area was the police man patrolling ? describe it
Determine if the sentence below describes a one-time event or a continuous event.¿Comiste una hamburguesa ayer?A. One-time eventB. Continuous event
Determine which ordered pairs given are solutions of the linear inequality in two variables.[tex]\[ x - y \ \textgreater \ 7 \][/tex]Ordered pairs: [tex]\((6,
A triangle has sides measuring 2 inches and 7 inches. If [tex]$x$[/tex] represents the length in inches of the third side, which inequality gives the range of p
Choose the correct definition for each sign of skin cancer:AsymmetryThe mole has ragged edgesThe mole is larger than a pencil eraserThe mole is growing in heigh
Vocabulary Annex The annex Intricate Embossed
Ginny AI Tutor write sentence using the words surprising, swim and play
The circumference of a circle is 8pi in. if the area is multiplied by 16, what happens to the radius? a. it is increased by a factor of 4. b. it is decreased by
Which statement describes the graph of this function? F(x) = -3 | x-1 | 12
The first few amino acids of the protein hemoglobin are given below: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALT How many alpha helices
Please provide some recommendation on the following issues with appropriate accounting treatments as per the Australian Accounting Standard.As at the beginning
Which suffix changes the meaning of memory to “to commit to memory”? -ize
Suppose that at the beginning of a loan contract, the real interest rate is 4% and expected inflation is currently 6%. if actual inflation turns out to be 7% ov
If the trend shown in these graphs stays constant, what percent of the market will parkas occupy in 2008? (Round your answer to the nearest tenth.) a. 16.5% b.